Reviewed,
UniProtKB/Swiss-Prot P20701 (ITAL_HUMAN)
Last modified
November 3, 2009.
Version 114.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Integrin alpha-L Alternative name(s): Leukocyte adhesion glycoprotein LFA-1 alpha chain Short name=LFA-1A Leukocyte function-associated molecule 1 alpha chain CD11 antigen-like family member A CD_antigen=CD11a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1170 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. |
| Subunit structure | Heterodimer of an alpha and a beta subunit. Alpha-L associates with beta-2. |
| Subcellular location | |
| Tissue specificity | Leukocytes. |
| Domain | The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage. |
| Sequence similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. Contains 1 VWFA domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ICAM3 | P32942 | 1 | EBI-961214,EBI-725421 | |
| Rassf5 | Q5EBH1 | 1 | EBI-961214,EBI-960530 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P20701-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P20701-2) The sequence of this isoform differs from the canonical sequence as follows: 954-954: Q → QGVHGLVEMQTSKQILCRPAGDAEHTVGAQEGELPCPWGVSEAFRDNIRAGPCR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | ||||||||||||||||||||||||||||||||||||||
| Chain | 26 – 1170 | 1145 | Integrin alpha-L | PRO_0000016292 | ||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||
| Topological domain | 26 – 1090 | 1065 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||
| Transmembrane | 1091 – 1111 | 21 | Potential | |||||||||||||||||||||||||||||||||||||
| Topological domain | 1112 – 1170 | 59 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||
| Repeat | 42 – 91 | 50 | FG-GAP 1 | |||||||||||||||||||||||||||||||||||||
| Repeat | 92 – 149 | 58 | FG-GAP 2 | |||||||||||||||||||||||||||||||||||||
| Domain | 156 – 327 | 172 | VWFA | |||||||||||||||||||||||||||||||||||||
| Repeat | 350 – 400 | 51 | FG-GAP 3 | |||||||||||||||||||||||||||||||||||||
| Repeat | 401 – 455 | 55 | FG-GAP 4 | |||||||||||||||||||||||||||||||||||||
| Repeat | 457 – 516 | 60 | FG-GAP 5 | |||||||||||||||||||||||||||||||||||||
| Repeat | 518 – 575 | 58 | FG-GAP 6 | |||||||||||||||||||||||||||||||||||||
| Repeat | 578 – 630 | 53 | FG-GAP 7 | |||||||||||||||||||||||||||||||||||||
| Calcium binding | 468 – 476 | 9 | Potential | |||||||||||||||||||||||||||||||||||||
| Calcium binding | 530 – 538 | 9 | Potential | |||||||||||||||||||||||||||||||||||||
| Calcium binding | 590 – 598 | 9 | Potential | |||||||||||||||||||||||||||||||||||||
| Motif | 1115 – 1119 | 5 | GFFKR motif | |||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 65 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 89 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 188 | 1 | N-linked (GlcNAc...) Ref.7 | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 649 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 670 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 726 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 730 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 862 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 885 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 897 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 1060 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Glycosylation | 1071 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||
| Disulfide bond | 73 ↔ 80 | By similarity | ||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 111 ↔ 129 | By similarity | ||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 653 ↔ 707 | By similarity | ||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 771 ↔ 777 | By similarity | ||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 845 ↔ 861 | By similarity | ||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 998 ↔ 1013 | By similarity | ||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1021 ↔ 1052 | By similarity | ||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 954 | 1 | Q → QGVHGLVEMQTSKQILCRPA GDAEHTVGAQEGELPCPWGV SEAFRDNIRAGPCR in isoform 2. | VSP_002738 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 144 | 1 | R → H: dbSNP rs34166708. Ref.3 | VAR_025235 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 214 | 1 | R → W: dbSNP rs1064524. Ref.3 Ref.1 Ref.2 | VAR_025236 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 746 | 1 | Q → K: dbSNP rs34838942. Ref.3 | VAR_025237 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 791 | 1 | R → T: dbSNP rs2230433. Ref.3 | VAR_025238 | ||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 660 | 1 | I → Y in CAA68747. Ref.1 | |||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 155 – 162 | 8 | ||||||||||||||||||||||||||||||||||||||
| Helix | 169 – 185 | 17 | ||||||||||||||||||||||||||||||||||||||
| Turn | 186 – 188 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 189 – 206 | 18 | ||||||||||||||||||||||||||||||||||||||
| Helix | 208 – 213 | 6 | ||||||||||||||||||||||||||||||||||||||
| Helix | 217 – 221 | 5 | ||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 243 | 11 | ||||||||||||||||||||||||||||||||||||||
| Helix | 247 – 249 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 255 – 265 | 11 | ||||||||||||||||||||||||||||||||||||||
| Helix | 274 – 276 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 279 – 287 | 9 | ||||||||||||||||||||||||||||||||||||||
| Helix | 288 – 290 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 297 | 5 | ||||||||||||||||||||||||||||||||||||||
| Helix | 298 – 302 | 5 | ||||||||||||||||||||||||||||||||||||||
| Helix | 307 – 310 | 4 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 311 – 317 | 7 | ||||||||||||||||||||||||||||||||||||||
| Helix | 319 – 328 | 10 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 331 – 333 | 3 | ||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Primary structure of the leukocyte function-associated molecule-1 alpha subunit: an integrin with an embedded domain defining a protein superfamily." Larson R.S., Corbi A.L., Berman L., Springer T. J. Cell Biol. 108:703-712(1989) [PubMed: 2537322] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, VARIANT TRP-214. |
| [2] | "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D. Genomics 60:295-308(1999) [PubMed: 10493829] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 2), VARIANT TRP-214. |
| [3] | NIEHS SNPs program Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-144; TRP-214; LYS-746 AND THR-791. |
| [4] | "Identification of cell-specific and developmentally regulated nuclear factors that direct myeloid and lymphoid expression of the CD11a gene." Shelley C.S., Farokhzad O.C., Arnaout M.A. Proc. Natl. Acad. Sci. U.S.A. 90:5364-5368(1993) [PubMed: 8099450] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-20. |
| [5] | "Characterization of the CD11a (alpha L, LFA-1 alpha) integrin gene promoter." Nueda A., Lopez-Cabrera M., Vara A., Corbi A.L. J. Biol. Chem. 268:19305-19311(1993) [PubMed: 8103515] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-20. |
| [6] | "Description of the leukocyte function-associated antigen 1 (LFA-1 or CD11a) promoter." Cornwell R.D., Gollahon K.A., Hickstein D.D. Proc. Natl. Acad. Sci. U.S.A. 90:4221-4225(1993) [PubMed: 8097887] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-20. |
| [7] | "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386(2009) [PubMed: 19349973] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-188, MASS SPECTROMETRY. |
| [8] | "Crystal structure of the I-domain from the CD11a/CD18 (LFA-1, alpha L beta 2) integrin." Qu A., Leahy D.J. Proc. Natl. Acad. Sci. U.S.A. 92:10277-10281(1995) [PubMed: 7479767] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 153-335, SEQUENCE REVISION TO 214. |
| [9] | "The role of the divalent cation in the structure of the I domain from the CD11a/CD18 integrin." Qu A., Leahy D.J. Structure 4:931-942(1996) [PubMed: 8805579] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 153-335. |
| [10] | "Structural basis for LFA-1 inhibition upon lovastatin binding to the CD11a I-domain." Kallen J., Welzenbach K., Ramage P., Geyl D., Kriwacki R., Legge G., Cottens S., Weitz-Schmidt G., Hommel U. J. Mol. Biol. 292:1-9(1999) [PubMed: 10493852] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 153-334. |
| [11] | "Structures of the alpha L I domain and its complex with ICAM-1 reveal a shape-shifting pathway for integrin regulation." Shimaoka M., Xiao T., Liu J.H., Yang Y., Dong Y., Jun C.D., McCormack A., Zhang R., Joachimiak A., Takagi J., Wang J.H., Springer T.A. Cell 112:99-111(2003) [PubMed: 12526797] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.3 ANGSTROMS) OF 155-331 IN COMPLEX WITH ICAM1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Y00796 mRNA. Translation: CAA68747.1. AC002310 Genomic DNA. Translation: AAC31672.1. DQ131904 Genomic DNA. Translation: AAZ38713.1. M95609 Genomic DNA. Translation: AAA16474.2. Z22804 Genomic DNA. Translation: CAA80461.1. M87662 Genomic DNA. No translation available. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00025380. IPI00219896. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S03308. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_002200.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.174103 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P20701. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000315171; ENSP00000321989; ENSG00000005844; Homo sapiens. [Genome view] ENST00000356798; ENSP00000349252; ENSG00000005844; Homo sapiens. [Genome view] ENST00000358164; ENSP00000350886; ENSG00000005844; Homo sapiens. [Genome view] ENST00000433423; ENSP00000409377; ENSG00000005844; Homo sapiens. [Genome view] ENST00000454514; ENSP00000408615; ENSG00000005844; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 3683. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002dyi.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 3683. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC16P030391. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6148. ITGAL. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB025011. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 153370. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA29948. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | LSFRKVE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | a4b1_paxdep_pathway. Paxillin-dependent events mediated by a4b1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_13552. Integrin cell surface interactions. REACT_604. Hemostasis. REACT_6900. Signaling in Immune system. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ITGAL. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P20701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000005844. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR013517. FG-GAP. IPR013519. Int_alpha_beta-p. IPR000413. Integrin_alpha. IPR013649. Integrin_alpha-2. IPR013513. Integrin_alpha_C. IPR018184. Integrin_alpha_C_CS. IPR002035. VWF_A. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01839. FG-GAP. 2 hits. PF00357. Integrin_alpha. 1 hit. PF08441. Integrin_alpha2. 1 hit. PF00092. VWA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01185. INTEGRINA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00191. Int_alpha. 5 hits. SM00327. VWA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00242. INTEGRIN_ALPHA. 1 hit. PS50234. VWFA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00095. Efalizumab. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 14415. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ITAL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P20701 Secondary accession number(s): O43746, Q45H73, Q9UBC8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


