Reviewed,
UniProtKB/Swiss-Prot O00192 (ARVC_HUMAN)
Last modified
November 3, 2009.
Version 91.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Armadillo repeat protein deleted in velo-cardio-facial syndrome | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 962 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in protein-protein interactions at adherens junctions. |
| Tissue specificity | Found in all the examined tissues including heart, brain, liver and kidney. Found at low level in lung. |
| Sequence similarities | Belongs to the beta-catenin family. Contains 10 ARM repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Ref.1 Traceable author statement. Source: ProtInc multicellular organismal development Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | intracellular Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | protein binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: O00192-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: O00192-2) The sequence of this isoform differs from the canonical sequence as follows: 1-69: MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVL → MPAELR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 962 | 962 | Armadillo repeat protein deleted in velo-cardio-facial syndrome | PRO_0000064294 | |||||
Regions | |||||||||
| Repeat | 348 – 387 | 40 | ARM 1 | ||||||
| Repeat | 390 – 429 | 40 | ARM 2 | ||||||
| Repeat | 433 – 467 | 35 | ARM 3 | ||||||
| Repeat | 468 – 508 | 41 | ARM 4 | ||||||
| Repeat | 526 – 565 | 40 | ARM 5 | ||||||
| Repeat | 575 – 622 | 48 | ARM 6 | ||||||
| Repeat | 646 – 686 | 41 | ARM 7 | ||||||
| Repeat | 699 – 738 | 40 | ARM 8 | ||||||
| Repeat | 739 – 781 | 43 | ARM 9 | ||||||
| Repeat | 782 – 826 | 45 | ARM 10 | ||||||
| Coiled coil | 8 – 46 | 39 | Potential | ||||||
| Motif | 607 – 623 | 17 | Nuclear localization signal Potential | ||||||
| Compositional bias | 608 – 611 | 4 | Poly-Arg | ||||||
Amino acid modifications | |||||||||
| Modified residue | 267 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 642 | 1 | Phosphothreonine Ref.3 | ||||||
| Modified residue | 864 | 1 | Phosphoserine Ref.3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 69 | 69 | MEDCN…QQLVL → MPAELR in isoform Short. | VSP_006739 | |||||
| Natural variant | 175 | 1 | V → A: dbSNP rs2240717. | VAR_020408 | |||||
| Natural variant | 220 | 1 | P → L: dbSNP rs2073748. | VAR_033529 | |||||
| Natural variant | 539 | 1 | R → Q: dbSNP rs16982871. | VAR_053812 | |||||
| Natural variant | 906 | 1 | R → Q: dbSNP rs165815. | VAR_024692 | |||||
| Natural variant | 909 | 1 | R → Q: dbSNP rs34638476. | VAR_033531 | |||||
| Natural variant | 909 | 1 | R → W: dbSNP rs34687532. | VAR_033530 | |||||
| Natural variant | 912 | 1 | R → W: dbSNP rs34445280. | VAR_033532 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| U51269 mRNA. Translation: AAC51202.1. AC005663 Genomic DNA. No translation available. | |
| IPI | IPI00010490. IPI00220492. |
| RefSeq | NP_001661.1. |
| UniGene | Hs.713616 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1M1E based on UniProtKB Q02248. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O00192. |
PTM databases | |
| PhosphoSite | O00192. |
Proteomic databases | |
| PRIDE | O00192. |
Genome annotation databases | |
| Ensembl | ENST00000263207; ENSP00000263207; ENSG00000099889; Homo sapiens. [Genome view] ENST00000344269; ENSP00000342042; ENSG00000099889; Homo sapiens. [Genome view] ENST00000401994; ENSP00000384341; ENSG00000099889; Homo sapiens. [Genome view] ENST00000406259; ENSP00000385444; ENSG00000099889; Homo sapiens. [Genome view] ENST00000406522; ENSP00000384732; ENSG00000099889; Homo sapiens. [Genome view] ENST00000430689; ENSP00000404252; ENSG00000099889; Homo sapiens. [Genome view] |
| GeneID | 421. |
| KEGG | hsa:421. |
| UCSC | uc002zqz.1. human. |
Organism-specific databases | |
| CTD | 421. |
| GeneCards | GC22M018331. |
| H-InvDB | HIX0016247. |
| HGNC | HGNC:728. ARVCF. |
| HPA | CAB016162. |
| MIM | 602269. gene. |
| Orphanet | 567. Monosomy 22q11. |
| PharmGKB | PA25018. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O00192. |
| HOVERGEN | O00192. |
| OMA | TYIRATV. |
Gene expression databases | |
| ArrayExpress | O00192. |
| Bgee | O00192. |
| Genevestigator | O00192. |
| GermOnline | ENSG00000099889. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR000225. Armadillo. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 1 hit. |
| Pfam | PF00514. Arm. 4 hits. [Graphical view] |
| SMART | SM00185. ARM. 6 hits. [Graphical view] |
| PROSITE | PS50176. ARM_REPEAT. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 1779. |
| SOURCE | Search... |
Entry information
| Entry name | ARVC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00192 Secondary accession number(s): B7WNV2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


